Defensin-1 (human) HNP-1,CAS :148093-65-6
Defensin-1 (human) HNP-1
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-1642 | 5mg | inquiry | ||
|
Product description
Defensin HNP-1 is a peptide secreted by polymorphonuclear leukocytes (PMNs) that has antimicrobial properties. It induces lysis of mammalian cells when used at concentrations of 25 and 100 µg/ml, respectively. Endogenous antibiotic peptide that exhibits a range of prominent anti-microbial activities against bacteria, fungi, and certain enveloped viruses.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 148093-65-6 |
Sequence | H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt) (Cys2 and 30 bridge, Cys4 and 19 bridge, Cys 9 and 29 bridge)/ACYCRIPACIAGERRYGTCIYQGRLWAFCC (C2&C30 bridg |
Molecular Formula | C150H222N44O38S6 |
Storage | -20℃,protected from light and moisture |
Transportation | 4-25℃ temperature for up to 2 weeks |
Stability | 1 year |
Document
Related Product