X
Email:
sales@ruixibiotech.com

Defensin-1 (human) HNP-1,CAS :148093-65-6

Defensin-1 (human) HNP-1

Catalog # Pkg Size Price(USD) Quantity Buy this product
R-M-1642 0.5mg 515.00
- +
+ Add to cart

Product description

Defensin HNP-1 is a peptide secreted by polymorphonuclear leukocytes (PMNs) that has antimicrobial properties. It induces lysis of mammalian cells when used at concentrations of 25 and 100 µg/ml, respectively. Endogenous antibiotic peptide that exhibits a range of prominent anti-microbial activities against bacteria, fungi, and certain enveloped viruses.


Appearance N/A
Molecular weight N/A
Purity >90%
Solubility N/A
Cas 148093-65-6
Sequence H-Ala-Cys-Tyr-Cys-Arg-Ile-Pro-Ala-Cys-Ile-Ala-Gly-Glu-Arg-Arg-Tyr-Gly-Thr-Cys-Ile-Tyr-Gln-Gly-Arg-Leu-Trp-Ala-Phe-Cys-Cys-OH (trifluoroacetate salt) (Cys2 and 30 bridge, Cys4 and 19 bridge, Cys 9 and 29 bridge)/ACYCRIPACIAGERRYGTCIYQGRLWAFCC (C2&C30 bridg
Molecular Formula C150H222N44O38S6
Storage -20℃,protected from light and moisture
Transportation 4-25℃ temperature for up to 2 weeks
Stability 1 year
Document

Related Product